SKU: 35661447784

HBV Surface Antigen-preS2 Protein

Sale price$86.40 Regular price$96.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 11 - Jul 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HBV Surface Antigen-preS2 ProteinProduct Specification Species HBV Synonyms Middle surface antigen; PreS2 Accession P03140 Amino Acid Sequence MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN Expression System E. coli Molecular Weight 5. 8 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 20mM PB, 50mM NaCl, pH7. 4 Reconstitution Reconstitute at less than 1

Product Specification


Species HBV
Synonyms Middle surface antigen; PreS2
Accession P03140
Amino Acid Sequence

MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN

Expression System E.coli
Molecular Weight

5.8 kDa(Reducing)

Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

20mM PB, 50mM NaCl, pH7.4

Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Hepatitis B surface antigen S2 (HBV Surface Antigen-preS2) is the smallest unit of transcriptional activator encoded by the surface gene of hepatitis B virus (HBV). It can be used as an auxiliary diagnostic reagent for hepatitis B virus infection. It exists in more than 1/3 of HBV integration units, and HBV integration units are an important factor in inducing liver cancer (HCC). HBV Surface Antigen-preS2 is also an effective regulator of apoptosis induced by tumor necrosis factor-related apoptosis-inducing ligand (TRAIL). It is involved in promoting hepatocyte apoptosis induced by TRAIL, thereby increasing the risk of malignant transformation of human hepatocellular carcinoma cell line (HepG2).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35661447784

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 2157 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Pistol King
Pawtucket, US
★★★★★ 5
Extremely comfortable
Color: 02-multicolour (4-pack), Size: X-Large
These are by far the softest and most comfortable underwear I have ever owned. The leg portion absolutely does roll up as so many others have mentioned, however, I did not find that to be uncomfortable at all just annoying that they don’t stay in place. I bought these specific underwear to see if it would help alleviate HS symptoms at all. They have definitely helped with wicking moisture away from the skin. More time will tell if it’s truly helpful for HS. For now, I will recommend these. They are thin, breathable, butter soft, wick moisture comfortable and I would buy again…maybe in a different style next time. I have washed them several times and they seem to be holding up rather well so that is also of supreme importance given the cost of the item. Again, I would recommend this item and plan on purchasing more in a different style very soon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 13, 2025
A
Verified Purchase
Amazon Customer
Draper, US
★★★★★ 3
Eaten by my Thighs
Color: 04-multicolour (4-pack), Size: X-Large
I wanted to love them. Sadly they have let me down. Pros: natural breathable fabric , super soft and comfortable, cotton panty gussets for feminine health and panty liners will stick!! Yay:). And the colors! They are great! But here’s the Con. And it’s the con of all cons. THEY RIDE UP!! Eaten by my thighs. I’m 5’6” and in the general area of 175. I fluctuate depending on how many times I visit the bakery! :) I don’t have a thigh gap but it is not a super tight thigh squeeze. I seldom have thigh climb but these do. I tried two different sizes to see if that made a difference. Nope. I was miserable at a recent theme park in these. I was wearing long heavy dresses and it was quite awkward to yank these legs down non stop. They feel amazing and they have all the requirements 1. Soft 2. Comfortable and stretches with you 3. Breathable with nice thin fabric. Not bulky 4. Natural fibers 5. Great colors If you are a person that is not blessed with Thunder Thighs, please order these. They are great! I wear them at home and to locations that I will not be doing a lot of walking at. I have washed them so many times and they look like new still.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 4, 2025
A
Verified Purchase
Ally Cat
Houston, US
★★★★★ 5
Best Boxer Briefs for Women!
Color: 09-multicolour (4-pack), Size: Large
I rarely give 5⭐️’s but these deserve it! Hands down, the most comfortable material, stitching, waistband, moisture wicking and overall comfort. They sit right beneath my bellybutton, they wash and dry well and they’re sturdy. I have tried 3 styles and these are the best.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 7, 2026
L
Verified Purchase
Liz Newman
Fort Morgan, US
★★★★★ 5
Comfortable and cool. Does not ride up.
Color: 01-multicolour (4-pack), Size: Medium
Extremely comfortable. Stays cool. Ample coverage. Quality material. They do not creep up. I ordered a medium which I generally take a size small. I have reordered and will reorder again to add more colors to my collection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
J
Verified Purchase
Janola
Lexington, US
★★★★★ 5
Great Value for Cool Thigh Protection
Color: 02-multicolour (4-pack), Size: XX-Large
For the price, I'm not sure there are better women's boxer shortlettes anywhere. I've tried more expensive brands, and for quality and cooling, these are right up there. I have other bamboo viscose undies that still get gross when I get sweaty in the summer, but these, with the large mesh panel, really help wick away a lot of that moisture, keeping you feeling dryer and cooler. I find that the leg openings are comfortable and don't roll up! and the waist band doesn't dig, nor does it roll down. These do not provide any compression, and I wasn't looking for any. I just wanted some cooling, thigh protecting women's boxers that wouldn't break the bank. These are them! Bonus- I've washed them and put them in the dryer (following their instructions), and they haven't shrunk; they look about the same and are nice and soft.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2025

recommand products