Human PCT(Procalcitonin), His Tag
SKU: 8158002725

Human PCT(Procalcitonin), His Tag

Sale price$168.75 Regular price$187.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PCT(Procalcitonin), His TagProduct Specification Species Human Synonyms PCT(Procalcitonin) Accession P01258 Amino Acid Sequence Protein sequence(P01258, Ala26 Asn141 with C 10*His) MAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ EREGSSLDSPRSKRCGNLST CMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 14. 6kDa Actual: 15kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms PCT(Procalcitonin)
Accession P01258
Amino Acid Sequence

Protein sequence(P01258, Ala26-Asn141 with C-10*His)


MAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ EREGSSLDSPRSKRCGNLST CMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANGGGGSHHHHHHHHHH 

Expression System E.coli
Molecular Weight Theoretical: 14.6kDa Actual: 15kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Procalcitonin (PCT) is a peptide precursor of the hormone calcitonin. The level of procalcitonin in the blood stream of healthy individuals is below the limit of detection (0.01 µg/L) of clinical assays. The level of procalcitonin rises in a response to a pro-inflammatory stimulus, especially of bacterial origin. Due to PCT’s variance between microbial infections and healthy individuals, it has become a marker to improve identification of bacterial infection and guide antibiotic therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8158002725

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 965 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Y
Verified Purchase
Yudit
Alexandria, US
★★★★★ 5
Muy buena para la piel
Me gusto mucho y muy efectiva
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
D
Verified Purchase
Darinka Gascon
Waukegan, US
★★★★★ 5
Recommended
⭐⭐⭐⭐⭐ "Excellent value for money and very efficient charging!" I bought this pack of 2 MagSafe chargers from TNDAJI and I couldn't be more satisfied. I love that it includes USB-C to USB-A adapters. This allows you to use them with both modern and traditional charging cubes, which is a great detail. The magnet adheres perfectly to my iPhone and does not release easily, allowing me to continue using the phone while charging. The blue light ring gives it a modern and elegant touch, in addition to helping to locate the charger easily in the dark without being annoying. The 15W works wonderfully. Charge my AirPods and phone quite fast for a wireless connection, and I haven't noticed excessive heating. For the price of an original one, you get two high-quality chargers with their adapters. Super recommended to have one in the office and another on the bedside table!"
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
C
Verified Purchase
Canada Goose
Lake Worth, US
★★★★★ 5
Great MagSafe charger set.
Great MagSafe charger set. The magnetic alignment is strong and keeps my iPhone securely in place without slipping. It charges quickly as described, especially with a proper PD adapter, and both my iPhone and AirPods work perfectly with it. I also like the soft LED light that doesn’t disturb sleep and the fact that it stays cool and feels safe during use. Having two chargers in the pack is very convenient. Overall, excellent value and very reliable—definitely 5 stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
Y
Verified Purchase
Yamisleidy
Massapequa, US
★★★★★ 5
Great Value and Convenient Charging Set
I’m really happy with this MagSafe Charger 2 Pack! The chargers are lightweight, easy to use, and connect perfectly to my phone with a strong magnetic hold. Charging is fast and reliable, and having two chargers is super convenient for home and travel. The cables feel durable and the overall quality is great for the price. Definitely a good purchase if you want an affordable alternative to expensive brand-name chargers. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
J
Verified Purchase
julie
Boise, US
★★★★★ 4
Not fast but steady
Not a fast charger but that’s not what I wanted - no over hearing experienced and using for overnight is no issue. With proper power brick it is very serviceable for topping off my 17pro and getting 2 for so cheap makes it a win for me
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026

recommand products