Human GP73, His tag
SKU: 93003400037

Human GP73, His tag

Sale price$218.25 Regular price$242.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GP73, His tagProduct Specification Species Human Synonyms Golgi membrane protein GP73, Golgi phosphoprotein 2, GOLM2 Accession Q8NBJ4 Amino Acid Sequence Protein sequence(Q8NBJ4, Arg55 Leu401, with C 10*His)

Product Specification


Species Human
Synonyms Golgi membrane protein GP73, Golgi phosphoprotein 2, GOLM2
Accession Q8NBJ4
Amino Acid Sequence

Protein sequence(Q8NBJ4, Arg55-Leu401, with C-10*His)
RAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 41kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Golgi protein-73 (GP73) is a type II Golgi-localized integral membrane protein that is normally expressed in epithelial cells of many human tissues. It is essential for human survival, and might have multiple roles for GP73 in epithelial cell function such as in the kidney and liver. GP73 has been suggested as a potential serum marker for the diagnosis of hepatocellular carcinoma (HCC),Several reports have stated that GP73 is a better marker than AFP for diagnos ing HCC. Many studies have demonstrated that significant increases of  non-viral causes (alcohol-induced liver dis ease, autoimmune hepatitis). Therefore, some researchers consider that an increase in GP73 expression is a common feature of hepatocyte response to a variety of disease etiologies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93003400037

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 802 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sungwook Kim
Dallas, US
★★★★★ 5
Affordability while being affordable
It works well, even better than $400 priced my previous TB4 hub at such a descent price. Even if I have some issues when I connect this to more than three usb devices at once, but the price of this item justifies its functionality as good as useful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
J
Verified Purchase
Jeff
Lake Worth, US
★★★★★ 5
Works well
Sometimes gets a little warm, but otherwise excellent. First USB-C (10gb) hub I've had that regularly handles 3 USB C drives without issue.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
G
Verified Purchase
Gerry M
Lake Worth, US
★★★★★ 5
Works with Viture XR Pro glasses!
So it is rare that I post about a product the same day that I got it but this USB-C hub did exactly what I wanted it to do! A little background, I recently got a pair of Viture XR Pro glasses and I am using them with a Samsung Galaxy S23 5G which has the benefit of Samsung DeX. The goal was to be able to use USB-A dongles for wireless keyboard and mouse in addition to charging my phone with a power delivery port and using my glasses. Long story short, it works flawlessly and I still have 1 USB-A and 3 USB-C ports to use!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
M
Verified Purchase
Merle C. Deardorff
San Leandro, US
★★★★★ 5
It Works for what I need.
I use the Hub as 192 Gb usb-c hub for 3 flash 64 gig F-Drives. Works great !
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
J
Verified Purchase
JJ
Boise, US
★★★★★ 4
Works well. Compact.
Works well. I have a camera monitor and my MacBook Air attached to it. I wish the cable were longer so I could push it all to the back of my desk. The cable is about 6 inches.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026

recommand products