Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD63, His tagProduct Specification Species Human Synonyms Granulophysin, Lysosomal associated membrane protein 3 (LAMP 3), Lysosome integral membrane protein 1 (Limp1), Melanoma associated antigen ME491, OMA81H Accession P08962 Amino Acid Sequence Protein sequence(P08962, Ala103 Val203, with C 10*His) AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight
Product Specification
| Species | Human |
| Synonyms | Granulophysin, Lysosomal-associated membrane protein 3 (LAMP-3), Lysosome integral membrane protein 1 (Limp1), Melanoma-associated antigen ME491, OMA81H |
| Accession | P08962 |
| Amino Acid Sequence | Protein sequence(P08962, Ala103-Val203, with C-10*His) |
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 13.2kDa Actual:17-30kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
|
Background
CD63 is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak Syndrome. Also this protein has been associated with tumor progression. CD63 is a good marker for flow cytometric quantification of in vitro activated basophils for diagnosis of IgE-mediated allergy.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy