Human IFN-alpha1, His tag
SKU: 72453167348

Human IFN-alpha1, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IFN-alpha1, His tagProduct Specification Species Human Synonyms IFN alpha 1 13; Interferon alpha D (LeIF D) Accession P01562 Amino Acid Sequence Protein sequence(P01562, Cys24 Glu189, with C 10*His) CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 21kDa Actual: 20kDa Purity 95% by SDS

Product Specification


Species Human
Synonyms IFN-alpha-1/13; Interferon alpha-D (LeIF D)
Accession P01562
Amino Acid Sequence

Protein sequence(P01562, Cys24-Glu189, with C-10*His)
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 21kDa Actual: 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

INF-α1 is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72453167348

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1122 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
Whitney Moore
Boise, US
★★★★★ 5
It’s an experience
Format: Paperback
⭐⭐⭐⭐⭐ **A Riveting and Emotionally Charged Journey** "Unwanted" by Sirena Song is an absolute masterpiece that grips you from the very first page and doesn't let go. The storytelling is impeccable, weaving together a tapestry of raw emotion, suspense, and heart-wrenching beauty. Song's ability to delve deep into the psyche of her characters makes them come alive, making you feel their pain, joy, and struggles as if they were your own. The plot is brilliantly crafted, full of unexpected twists and turns that keep you on the edge of your seat. Each chapter unfolds like a piece of a complex puzzle, gradually revealing the depth of the narrative. The themes of love, rejection, and redemption are explored with such nuance and sensitivity that it leaves a lasting impact. Sirena Song's prose is poetic and evocative, painting vivid pictures with her words and creating an immersive reading experience. The character development is outstanding, making it easy to become emotionally invested in their journeys. The ending is both satisfying and thought-provoking, leaving you pondering long after you've turned the last page. "Unwanted" is not just a book; it's an experience that touches the soul. I highly recommend it to anyone looking for a powerful and unforgettable read. Sirena Song has truly outdone herself with this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2024
T
Verified Purchase
TeamCieluch
Phoenix, US
★★★★★ 4
Totally Sweet
Format: Kindle
🔥OmegaVerse 🔥Single Mom 🔥Scent Match 🔥Emotional Trauma Well written, emotional omegaverse about a single mom of 2 with an ex-Alpha boyfriend that found his Omega and ditched his family. Cammie has a meet cute with Reid and Finton separately but they both find her to be their scent match. This book is totally sweet with lots of drama but lots of proving to Cammie that she is loved and wanted. My Personal Ratings: 5 Stars: Loved it! Couldn’t put it down or obsessed about it while needing to get to the end of it. Had to share some bits with my hubby!! Usually read in less than 2 days cause a girl has got to sleep sometime. Will be reading everything this author has to offer and most likely reread the series as next books in the series are released. 4 Stars: Really Good. Whether the story drew me in or a specific character, will definitely continue the series and look into more books by this author. 3 Stars: Enjoyed something about the book, whether it be the storyline or a character but also may have not liked something. Sometimes the book is great but needs some TLC from an editor. May or may not continue the series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2024
R
Verified Purchase
Rae
Fort Morgan, US
★★★★★ 5
Read it!!! It's so good!
Format: Kindle
I will reccomend this book to anyone and everyone who is looking for an omegaverse book to read! The rabbit hole of male omega books this one sent my mood reading self down was crazy! 🤭 I could not have loved Finn more! He was the sweetest omega, making sure Cammie was comfortable each step of building a relationship with him and Reid. He was so good with the kids even though Ben was a little rough around the edges. Cammie's fears were all justified but the way she learned to trust her new pack was sweet! They just continued to show up and her sister was hilarious! Being a mom and thinking of her littles but also finding her own happiness was such a sweet journey for her 💖 lets just talk about the kids for a second and say Em is a spitfire and I LOVE her and Ben sweet Ben just wants to protect his Mama but needs love, Reid does such a good job stepping up! And the 'gift' at the end had me in tears!! 🥹 Without giving too much away that is why I think sweet Finn is my favorite of all male omegas I have ever read! His way with words no matter what he is using them for, declarations of love, pep talks, or advice he really just knows what needs to be said 💖
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2025
M
Verified Purchase
Megan Kennedy
Waukegan, US
★★★★★ 3
I wanted to like this more than I did
Format: Kindle
This started off so well! I thought it was going to take Lola on a run for her money but it ended up getting weird. I liked the writing but there was just too much spice which I didn't think was possible for me. There were too many times that the writing felt weird or the situations too outlandish and unrealistic. I had to skim through a lot of the later half. It might just be the dynamic between the characters that didn't work for me so I'll give this author another go.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 7, 2025
J
Verified Purchase
JB
West Palm Beach, US
★★★★★ 5
love love love!!
Format: Kindle
Unwanted is the perfect hurt/comfort romance read. I LOVE an OV romance where the beta is the center of the story and Song delivers a heartfelt story of a single mom to 2, burned by her alpha-hole ex starting her life over in the small town of Knotty Pines. Reid and Finn are an alpha/omega pair who’ve been together since they scent matched as teenagers, they’ve always known someone was missing in their lives and they’ll stop at nothing to prove to Cammie that her, Em & Ben are everything they always wanted. I couldn’t put this one down - Song tugs at your heart strings, and gives you vulnerable, real and lovable characters with depth and relatability. The book is so well paced, detailed to perfection without overdoing it or straying, I really honestly loved the flow and details in this story and the banter and humor had me smiling throughout this read. This was the perfect hurt/comfort, who did this to you, fated mates, stop at nothing to get the girl romance that I’ll be recommending for the foreseeable future!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2024

recommand products