Monkeypox virus A35R, His Tag
SKU: 31809880371

Monkeypox virus A35R, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Monkeypox virus A35R, His TagProduct Specification Species MPXV Synonyms Mpox, Monkeypox Accession Q80KX2 Amino Acid Sequence Protein sequence(Q80KX2, Val57 Thr181, with C 10*His) VRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 15. 4kDa Actual: 15kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species MPXV
Synonyms Mpox, Monkeypox
Accession Q80KX2
Amino Acid Sequence

Protein sequence(Q80KX2, Val57-Thr181, with C-10*His)


VRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 15.4kDa Actual: 15kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Monkeypox A35R is a homolog of Vaccinia virus A33R protein. A33R is specifically incorporated into the viral outer envelope. The protein is expressed early and late after infection, cosistent with putative early and late promoter sequences. And it is necessay for efficient cell-to-cell spread.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 31809880371

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 1422 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
brownie2009
Lake Worth, US
★★★★★ 5
Dog loves them
Size: 6 Inch, Color: Independence Day
My dog loved the first ball I got her, so I got her a second one. Both hhavr been very durable (she likes to puncture things with her teeth). I left each ball slightly deflated, so they were still firm, but she could bite them without issues. She has not punctured either ball yet. I did have to watch her because she started trying to chew the tabs off because she was bored. She has not chewed one off, just started thinking about it, and did a tiny bit of damage to one tab. She loves these balls. We have played tug of wat with them too, so yhe tabs are sturdy, and so is the ball. The dog did not care what collar she got, so I grabbed the least expensive one, and the 6 inch. She is a medium sized dog with razor teeth, and these work great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
R
Verified Purchase
Russell Taft
Massapequa, US
★★★★★ 4
Not recommended for the aggressive player..
Size: 6 Inch, Color: Red, Size: 6 Inch, Color: Red
First this ball was not delivered when it should have been. Second, the tabs are poorly made. One day of my dog playing with it and the tabs are already torn up. The ball itself is fun for her and has not deflated for now at least.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
M
Verified Purchase
Mauro
Natrona Heights, US
★★★★★ 5
Best
Size: 10, Color: Espresso II/Black
The best flop ever made
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
J
JA Cook
Boise, US
★★★★★ 5
Best flip-flops I've met
Size: 11, Color: Black/Geyser
Right away I was impressed by the thichness and cushioning of these flip-flops. They are not a flimsy piece of rubber under my foot. The sole is more like that of an athletic shoe with layers and an impressive tread. I've always found that my heel sits too much on the back edge of flip-flops, or even over it. So I ordered these just a half size large and they're perfect. The foot cradling allows my heel to sit down inside the flip-flop comfortably and securely. They're not about to fall off. The toe piece (I don't know what it's actually called) is not just the typical round rubber post. On these flip-flops it's nicely shaped and fits comfortably between my toes. The arch support is nice too. They're not just flat. In spite of being more substantial than the cheapies we all know, these remain lightweight. They clearly look better too
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
A
A1 reviewer
Grantham, US
★★★★★ 5
Well made
Size: 11, Color: Black/Geyser
The first thing that stands out about the Columbia PFG Castback Flip sandals is the solid build and clean fishing-inspired design. The Black/Geyser color combination looks sharp and matches the product photos well. The straps feel durable and comfortable against the foot, and the footbed has a slightly cushioned feel that makes them comfortable right out of the box. Overall construction feels sturdy, which is what you’d expect from something designed for outdoor or water use. In everyday wear, the sandals are comfortable and easy to walk in. The footbed provides decent grip and support, and the textured surface helps keep your foot from sliding around when they get wet. They work well for casual use, whether it’s around the house, at the beach, or after a day on the water. The lightweight feel also makes them easy to pack for trips or outdoor activities. After wearing them for a while, they hold up well and remain comfortable for daily use. The materials seem durable and the straps stay secure without stretching out. They’re simple, reliable sandals that work well for warm weather, boating, or casual summer wear. Overall, they’re a solid choice for anyone looking for comfortable flip flops with a slightly more rugged outdoor style.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026

recommand products