Human CGB3, His tag
SKU: 62327756325

Human CGB3, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CGB3, His tagProduct Specification Species Human Synonyms Choriogonadotropin subunit beta (CG beta); Chorionic gonadotropin chain beta Accession P0DN86 Amino Acid Sequence Protein sequence(P0DN86, Ser21 Gln165, with C 10*His) SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 17. 2kDa Actual: 33kDa

Product Specification


Species Human
Synonyms Choriogonadotropin subunit beta (CG-beta); Chorionic gonadotropin chain beta
Accession P0DN86
Amino Acid Sequence

Protein sequence(P0DN86, Ser21-Gln165, with C-10*His)
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 17.2kDa Actual: 33kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

CGB3 is a protein that in humans is encoded by the CGB gene. This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin. Glycoprotein hormones are heterodimers consisting of a common alpha subunit and a unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62327756325

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 1115 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Ernie Duchek
New York, US
★★★★★ 5
Top notch tire sealant!
Size: 20oz
Really good sealant that lives up to it's description. Very easy to use and definitely delivers. Have used it on several Lazer Z mowers and works as advertised! Definitely would recommend this one!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
T
Verified Purchase
Thorin C. Guidry
Pawtucket, US
★★★★★ 5
This stuff just works! Very impressed. If you have a slow leak, get this!
Size: 20oz
This is the second time I've bought this product. I bought one initially to test it out and I was very impressed! I had put some used tires on some used rims for my side by side and I had a couple of them leaking slowly from the side of the rim. I put this stuff in, following the directions and have no more leaks! It's been about a week with the first one, and zero loss in air pressure. I took my side by side out on the trails and thrashed around a bit, still no leaks! This stuff is legit! It comes with a valve removal tool and red valve stem covers to show you which tires you've added this too. Very easy to use, no issues whatsoever. Saves you money having to take your tires somewhere to have them look at them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 15, 2025
R
Verified Purchase
Robert
Louisville, US
★★★★★ 5
This stuff worked better than I thought it would
Size: 40oz
As my title says, this stuff worked better than I thought it would. In fact it worked so well today I will be ordering more. I say today because how can you tell if something like this is actually working... never getting a flat for years? In other words, if it fixes a flat before your eyes it works, otherwise you really don't know. See I had a lawn mower tractor that developed a real bad tire leak a couple of days ago. The way it happened was I cut a Russian Olive tree down, if you know what one of these trees are like, you already know why I got such a bad leak. These darn things have thorns that can get to be almost as big around as a pencil, and are just as sharp as a needle. Moreover, these spikes as I call them, can get to be 3" to 4" long. In short, if you run over one you will have a flat tire, period. That is unless you have this stuff inside the tire already. To make matters worse, if you run over a branch from this tree, you won't only get one or two thorns/spikes stuck in your tire, because as you drive the branch bends easily (only the spike are ridged), so before you know it you will end up with a half dozen of these spikes all the way around your tire, as if the whole tire has a new tread made up of a Russian Olive tree branch. Trust me on this, it will happen just like this. After pulling a half dozen 2" to 4" inch spikes out of the tire, I knew if I took it to a shop they would require me to put a tube in. With this inflation that isn't supposed to be an inflation going on, I'm sure it has made tire tubes today cost almost as much as the whole tire cost me just a couple of years ago. So I thought I'd put this product to a real test... I already have some in my John Deere 2305 tractor. Honestly, it shocked me how quick it worked. It worked so fast I didn't even need to add anymore air to the tire, because all the holes were shut. Pretty amazing stuff if you ask me! I followed the directions, they were easy to follow and the process was easy too. I removed the valve stem, put in 5 ounces of the solution, then put the valve stem back in, aired up the tire and it was instantly fixed... amazing, especially considering why the tire was flat... I should have taken a pic of the spikes. I did roll the tire around a bit, then mounted the tire back on the tractor and went right over and mowed my elderly neighbors lawn, so it got plenty of rotation time. That was about 4 hours ago and the tire is still rock hard. Like I said, I'm ordering more because after seeing this everything we have that runs slow will have this stuff in the tires! Oh, one other thing. The fix-it flat stuff in a spray can, DO NOT USE IT for applications like this! Because that stuff if left inside will actually glue your tire to the rim. Tires have been ruined trying to pry them away from the rim after putting in fix-a-flat, or whatever that crap is called. Sadly this "TireJect" is not recommended for high speed travel, it will through your tire out of balance. So use the fix-flat stuff in an emergency, carry one in your car just in case. Just make sure once you get the tire fixed wash the tire out real good before remounting it. I have never written such a long review in my life, but if you got through it I hope it helped. It's not often a product lives up to it's claims today, but this one in my opinion surpasses it, so I felt the need to say something. Besides, the warning about the Russian Olive tree just may save someone a lot of frustrations.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2023
J
Verified Purchase
Juno
Dallas, US
★★★★★ 5
It Really Works!
Size: 40oz
Excellent product-stops leaks!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
B
Verified Purchase
Bruce
West Palm Beach, US
★★★★★ 4
SEEMS TO WORK WELL... IF YOU CAN GET IT INTO THE TIRE
Size: 10oz, Size: 10oz
The front 11x6 tires of our Scag ZTR mower leaked air around the bead (a common problem). I bought one 10-oz bag to treat them, for about $22. No matter how much I squeezed and squeezed, it would not dispense product. Turns out a small plug of "something" had clogged the hole in the cap (see photo). This might not be a problem for the syringe version but it sure was with the bag. After discarding about an ounce of product and clearing the hole with a finishing nail, I was able to treat both tires. I drove the mower for ~15 minutes. Four days later they seem to be holding air. Previously, they went flat in two days. So it seems to be working, but I have to drop a star for a flawed delivery system. If the tires start going flat again within an unreasonable period of time I'll come back and update this report.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026

recommand products