Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 7 - Jul 12
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human IFN-α2, His TagProduct Specification Species Human Synonyms Interferon alpha 2, Interferon alpha A,IFNA2 Accession P01563 Amino Acid Sequence Protein sequence(P01563, Cys24 Glu188, with C 10*His) CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 20. 9kDa Actual: 20,24kDa Purity >95%
Product Specification
| Species | Human |
| Synonyms | Interferon alpha-2, Interferon alpha-A,IFNA2 |
| Accession | P01563 |
| Amino Acid Sequence | Protein sequence(P01563, Cys24-Glu188, with C-10*His) CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:20.9kDa Actual:20,24kDa |
| Purity | >95% by SDS-PAGE |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Human interferon alpha-2 (IFNα2) is a cytokine belonging to the family of type I IFNs. IFNα2 is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection.IFNα2 was the first subtype to be characterized in the early eighties. As a result, IFNα2 was widely used in basic research to elucidate biological activities, structure and mechanism of action of type I IFNs. IFNα2 was also the first IFN to be produced by the pharmaceutical industry for use as a drug.In addition to their antiviral activity, type I IFNs also inhibit the proliferation of cells and regulate the activation of the immune system.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy