Human TIMP-1, His tag
SKU: 23098685157

Human TIMP-1, His tag

Sale price$222.75 Regular price$247.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TIMP-1, His tagProduct Specification Species Human Synonyms Erythroid potentiating activity (EPA), Fibroblast collagenase inhibitor (Collagenase inhibitor), metalloproteinases inhibitor 1 Accession P01033 Amino Acid Sequence Protein sequence (P01033, Cys24 Ala207, with C 10*His)

Product Specification


Species Human
Synonyms Erythroid-potentiating activity (EPA), Fibroblast collagenase inhibitor (Collagenase inhibitor), metalloproteinases inhibitor 1
Accession P01033
Amino Acid Sequence

Protein sequence (P01033, Cys24-Ala207, with C-10*His) CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 22.3kDa Actual: 33kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied. 

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.

Background

TIMP metallopeptidase inhibitor 1, also known as TIMP1, a tissue inhibitor of metalloproteinases, is a glycoprotein with a molecular weight of 28 kDa.TIMP1 is expressed from several tissues of organisms. TIMP1 is an inhibitory molecule that regulates matrix metalloproteinases (MMPs), and disintegrin-metalloproteinases (ADAMs and ADAMTSs). In regulating MMPs, TIMP1 plays a crucial role in extracellular matrix (ECM) composition, wound healing, and pregnancy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23098685157

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 1805 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Megan Cusack
New York, US
★★★★★ 5
Love these floating shelves!
Color: Oak, Number Of Shelves: 2, Size: 36"W x 6.5"D
These shelves are perfect for my kitchen! They were easy to install. All the hardware was included. They are durable and sturdy and gave my kitchen wall an instant face lift!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
A
Verified Purchase
A. Tucker
West Palm Beach, US
★★★★★ 3
Holes in brackets are not spaced for studs!
Color: White, Number Of Shelves: 2, Size: 67"W x 6.5"D
So the quality of this not great, but good enough and they look nice enough on the wall. However, the bracket holes are not spaced at 16" intervals. WTF? I'm not sure who designed this thing. The molly plugs that came with it look OK, but to play it safe I used a cobalt steel drill bit and made my own holes in the bracket. Easy enough with some wd40. My other pick with this is that the screws to anchor the shelf to the bracket are black and and very obvious... they should have supplied some kind of cap.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
A
Verified Purchase
Ashley
Charlottesville, US
★★★★★ 5
Nice, make sure the measurements are what you want!
Color: Black, Color: Black
I like these shelves, just make sure to read the measurements , because they are a little narrow, but perfect for what I used them for. They added a sleek look to my wall. I'm a very plain Jane kind of person and I've gotten compliments from my friends. I used them to put my crystal collection on and they are holding up. I did use these new screws and anchors from tiktok to hold them up, not the screws these came with because I don't like the plastic anchors. The size is perfect and with a little help with straightness, I got four up out of six.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
M
Verified Purchase
Maria
Boise, US
★★★★★ 5
Me encantó el producto
Color: White, Color: White
Encantada 💜me gusto mucho lo recomiendo
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
J
Verified Purchase
Jarvis Buczynski
Boise, US
★★★★★ 1
Glue separated within five minutes of being hung up
Color: White
I do not recommend. As I was hanging them, the shelves looked like they were already going to separate. I hung them up and I put a couple books on a few different ones as well as some trinkets not weighing even 5 pounds (so not even close to the weight). Within five minutes. One of the shelves snapped. They look okay, are light and are super easy to use, but the quality is horrible. I would say the best part about this is the hardware and mini levels it comes with. Definitely not worth it. I’m sure you can find something better for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026

recommand products