Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 7 - Jul 12
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human S100B, His TagProduct Specification Species Human Synonyms S 100 protein beta chain, S 100 protein subunit beta, S100 calcium binding protein B Accession P04271 Amino Acid Sequence Protein sequence(P04271, Ser2 Glu92 with C 10*His) MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHEGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 12. 4kDa Actual: 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g
Product Specification
| Species | Human |
| Synonyms | S-100 protein beta chain, S-100 protein subunit beta, S100 calcium-binding protein B |
| Accession | P04271 |
| Amino Acid Sequence |
Protein sequence(P04271, Ser2-Glu92 with C-10*His)
|
| Expression System | E.coli |
| Molecular Weight | Theoretical: 12.4kDa Actual: 12kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
S100 calcium-binding protein B (S100B) is a protein of the S-100 protein family. S100 proteins are localized in the cytoplasm and nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100B is glial-specific and is expressed primarily by astrocytes, but not all astrocytes express S100B. It has been shown that S100B is only expressed by a subtype of mature astrocytes that ensheath blood vessels and by NG2-expressing cells. Serum levels of S100B increase in patients during the acute phase of brain damage. Over the last decade, S100B has emerged as a candidate peripheral biomarker of blood–brain barrier (BBB) permeability and CNS injury.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 1994 reviews
Sort
Product Reviews
★★★★★ 4
He was OBSESSED!!!
Size: Large, Color: Dinos Frills (Gray), Size: Large, Color: Dinos Frills (Gray)
Our year and a half old lab was excited the moment he saw it come out of the box ! He had many toys that he tore into shreds within a day so this was his first “heavy toy “ that wasn’t easy to tear .
I think he loves the design and feel of it , as he carried this thing EVERYWHERE and even to bed . Him and his sister share toys but this was his , he claimed it lol
Now if it wasn’t for us telling him to stop trying to kill the Dino he could have easily tore into this thing within a couple of days . However since he started chewing gently he became obsessed with the squeaker , and used that as an alarm that he was up every morning in bed 😂
The quality of the product is actually pretty good but it’s not bullet proof, and our smart dog was able to sneakily tear a whole in the nose and some how pull out the stuffing .
All in all I would definitely buy another toy from this company because they are made with quality for dogs , and lasted about three weeks longer than his average toys ! It was his favorite toy 💕
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2023
★★★★★ 3
Not indestructible
Size: Large, Color: Dinos Frills (Gray)
When I googled “indestructible stuffy dog toys” this popped up. My 9 month old pup loves stuffies but destroys them quickly and eats stuffing if not caught quickly. Well, this indestructible toy is cute but my dog had it torn apart in under 4 minutes so…🤷🏻♀️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
★★★★★ 5
Great for Tough chewers!
Size: Large, Color: Dinos Frills (Red)
My dog is a tough chewer and absolutely loves this toy! He was able to get a little stuffing out of the leg so far and it’s been about a week. This might sound like a short amount of time but it usually takes him under 15 mins to unstuff a large toy even if they are advertised for “tough chewers!” This is a very large size toy and would be good for any larger breed. He carries it around the house and constantly keeps his Dino with him. Since Ive found GoDog toys I’ve only been purchasing them because of their durability. I’ve tried Kong and Bark toys previously and they just do hold up long and are usually more expensive. This toy is a great value and dogs love them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 20, 2025
★★★★★ 5
Super cool strong dog toy!
Size: Large, Color: Dinos Frills (Red)
Super cool strong dog toy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
★★★★★ 4
LOVE this brand. Have many of their styles. This is basically an unstuffed toy.
Size: Large, Color: Dinos Frills (Gray)
I have about 10 -12 different styles of the GoDog brand toys. It is like Xmas when my Malinois dogs get a new GoDog toy. Have loved this brand for many years and have some toys which have lasted 5-6 years -- minor "surgeries" stitch they back together -- until I retired them. They have never just worn out. Just to be clear:
THESE TOYS ARE NOT CHEW PROOF. NO STUFFED TOY IS CHEW PROOF.
However, this brand of stuffed toy is more chew proof than other brands. But if you are looking for a chew proof stuffed toy be advised -- IT DOES NOT EXIST!! No fabric is chew proof. Even if they invented such a fabric I would not want to ruin my dog's teeth by letting them try to chew through it. Protecting one's dog's teeth should be the highest priority.
If a dog can chew through a PLASTIC KENNEL and even METAL WIRE KENNELS (yes, it happens) then they can easily chew through a puffy, fluffy stuffed toy. The "Chew Guard Technology" language may be misleading to some customers who are disappointed in the brand. I defend the brand and have used it for many years. No, I don't get paid or get free toys.
Since I have had many styles within this brand and even have the pink version of this style I thought I knew what I was getting. This is basically a toy without stuffing which some people prefer. For whatever reasons my dogs prefer toys that are stuffed. Really stuffed with a firm density that they can sink their teeth into. So this toy will be OK. I can tell it will not be one of their beloved toys like some of the brand's other styles such as the purple brontosaurus. My fault for not reading more closely and assuming the grey version would be exactly like the pink version which is fully stuffed. If they get bored with these two I keep some of the Chew Guard toys stock piled.
BTW one can wash and dry these toys. Yes, eventually the squeakers suck up some water and die but one can replace the squeakers. Also on Amazon. So I am willing to replace the squeakers a few times in the life time of one of these toys to be able to wash and dry them occasionally. Usually takes a couple drying cycles to get the heavily stuffed toys dried completely.
If you have an aggressive chewer you may wish to look into Goughnuts dog toys or other hard rubber toys that are designed for aggressive chewers. Even then, with a determined dog, the Goughnuts toys can be chewed through. I think they offer a replacement guarantee. The other brand which has some toys of hard rubber is West Paw. An excellent brand that also offers a one time replacement. Bully Sticks are another option for chewers.
PLEASE, PLEASE, PLEASE stay away from the hard plastic chew toys like the Nyla Bones. Hard plastic toys will destroy your dog's teeth over time. I learned the hard way (no pun intended) and ruined one of my dog's teeth. Vet asked if I allowed my dog to chew ROCKS !!!!!! Every tooth was cracked or fractured. Not wishing to pull teeth I had to pay for some very expensive root canals and caps. Vet's advise: If you can't dent the toy or chew with your finger nail DO NOT offer to your dog. Good advise to follow. Even some of the Bully Sticks (Costco Brand) are so hard they can chip or fracture teeth.
Best for you and your dog.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2019
recommand products
CA 1181 - Fulbourn Village Hospital, Cambridgeshire
10.95
CA 1195 - High Street, Burwell, Cambridgeshire
13.00
CA 1112 - Wisbech Armistice Day, Cambridgeshire 1918 WW1
10.95
CA 1271 - Burwell Regatta Fete, Cambridgeshire 1908
13.00
CA 1267 - Rose & Crown Hotel, High Street, Wisbech, Cambridgeshire
13.00